PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G005866.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 172aa    MW: 19541.3 Da    PI: 5.2611
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G005866.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.81.2e-40181171100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaC++lrr+C ++Cvl+pyfp e+ ++fa vhk+FGasn++k+++ ++e++r+d+++s+vyeA ar+rdPvyG++g+i++lq+ +++
  HL.SW.v1.0.G005866.1  18 PCAACRMLRRRCDRNCVLSPYFPPEEIENFAGVHKVFGASNIIKMIQMVEETKRDDTVKSIVYEATARMRDPVYGCAGTIFHLQKMVSE 106
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+++l+++ ++
  HL.SW.v1.0.G005866.1 107 LRSQLETTTAQ 117
                           *****998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.32217118IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4018114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEPSTDQAPI PRARLHQPCA ACRMLRRRCD RNCVLSPYFP PEEIENFAGV HKVFGASNII  60
KMIQMVEETK RDDTVKSIVY EATARMRDPV YGCAGTIFHL QKMVSELRSQ LETTTAQVMD  120
LQEQRDKLLG LLMNNAQYYV DFDPSTTTTT QWLDPVFDGC TTSSIYDSFP F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007219714.11e-71hypothetical protein PRUPE_ppa025888mg
SwissprotQ9SK087e-48LBD11_ARATH; LOB domain-containing protein 11
TrEMBLM5XHG31e-71M5XHG3_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s16510.17e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-49LOB domain-containing protein 11